CAS 946870-92-4 İnsan Büyümesi Peptidleri IGF-1 DES 1mg İnsülin Benzeri Büyüme Faktörü UZUN İGF-1

Temel bilgi
Menşe yeri: Çin
Marka adı: GSP
Sertifika: ISO9001,SGS,UKAS,GMP
Model numarası: IGF-1 DES
Min sipariş miktarı: Ücretsiz Örnekler kullanılabilir
Fiyat: Negotiable
Ambalaj bilgileri: 10iu / şişe, 10vials / kit
Teslim süresi: 3-6 iş günü
Ödeme koşulları: Western Union, MoneyGram, T / T, Bitcoins
Yetenek temini: 10000-30000iu / ay
takma ad: IGF-1 Uzun R3 Özellikler: 0.1mg,1mg,1g
Eş anlamlı: Uzun R3-IGF-1 Paketleme: Gümrük geçişi için gizli paketleme garantilidir
Görünüm: Beyaz Liyofilize Toz CAS: 946870-92-4
E-posta: tonyraws810@gmail.com Naber: 86-15871352379
hasır: tonyraws
Vurgulamak:

muscle building peptides

,

Büyüme hormonu Peptides

E.Coli'de üretilen IGF-I Des(1-3) İnsan Rekombinantı, 67 amino asit (aa 4-70) içeren ve moleküler kütlesi 7368.5 Dalton olan tek, glikosile edilmemiş bir polipeptit zinciridir.
IGF-1 Des1-3, tescilli kromatografik tekniklerle saflaştırılır.

 

İnsan Büyüme Peptidleri IGF-1 DES 1mg İnsülin Benzeri Büyüme Faktörü LONG IGF-1

 

İnsülin Benzeri Büyüme Faktörü-1 DES (1-3):

 

Sıra

TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLK

PAKSA

Eş anlamlı

Somatomedin C, IGF-I, IGFI, IGF1, IGF-IA, Mekanik büyüme faktörü, MGF, Des(1-3), Des1-3,

Des 1-3, Des (1-3), IGF-1 (4-70).

Fiziksel görünüş Steril Filtrelenmiş Beyaz liyofilize (dondurularak kurutulmuş) toz
çözünürlük

IGF-I des(1-3)'ün steril 18M-cm H2O içinde en az

100 ug/ml, daha sonra diğer sulu çözeltilere seyreltilebilir.

Saflık Şunlar tarafından belirlendiği üzere %97.0'dan büyük:
(a) RP-HPLC ile analiz.
(b) SDS-PAGE ile analiz.
kullanım

ProSpec'in ürünleri YALNIZCA LABORATUVAR ARAŞTIRMA KULLANIMI için döşenmiştir.Ürün

ilaç, tarım veya pestisit ürünleri, gıda katkı maddeleri veya ev kimyasalları olarak kullanılamaz.

 

 

 

 

 

 

 

 

 

 

 

 

 

 

 

Açıklamalar:

 

DES IGF-1IGF-1 zincirinin daha kısa versiyonudur.IGF-LR3'ten beş (5) kat ve normal temel IGF-1'den on (10) kat daha güçlüdür.DES'in yarı ömrü yaklaşık 20-30 dakikadır, bu da bunun çok hassas bir zincir olduğu anlamına gelir.Bu nedenle uygulama sadece kas büyümesini görmek istediğiniz bölgede yapılmalıdır.DES, kas hiperplazisini LR3'ten daha iyi uyarma yeteneğine sahiptir.Basit bir ifadeyle, genel büyümeden ziyade site enjeksiyonları için en iyi şekilde kullanılır.

 

Ek olarak, DES'in egzersiz sırasında sıklıkla bulunan laktik asit tarafından deforme olmuş reseptörlere bağlandığı bilinmektedir.Bu, DES'nin kendisini mutasyona uğramış bir reseptöre bağlamasına ve eğitim sırasında doku büyümesine işaret etmesine izin verir.DES, LR3'ten daha uzun ve daha sık kullanılabilir.

 

IGF1 DES:

 

E. coli'de üretilen, IGF-1 DES olarak da bilinen İnsülin Benzeri Büyüme Faktörü (IGF)-1 (4-70), 67 amino asit içeren ve 7.372 moleküler kütleye sahip tek, glikosile edilmemiş bir polipeptit zinciridir. babaIn vitro çalışmalar, eşit dozlarda DES (1-3) IGF'nin, kültürlenmiş hücrelerde hipertrofi ve proliferasyonun uyarılmasında IGF-1'den on kat daha güçlü olduğunu göstermektedir.Muhtemelen proteaz eylemi yoluyla dolaşımdaki olgun IGF-1 dizisindeki translasyon sonrası modifikasyon yoluyla üretilir.

 

IGF-1 DES, IGF-1'in parçalanmış bir formudur ve 4-70 amino asitlerini içerir.Bu yapı, IGF-1 proteininin etkilerinin, İnsülin benzeri büyüme faktörü 1'in DES 1,3 molekül peptit protein parçasının daha kararlı formunda amplifiye edilmesine izin vermiştir. IGF-1 DES veya insülin benzeri büyüme faktörü. DES, memelilerin büyüme ve gelişmesinde önemli rol oynayan peptitlerin IGF-1 ailesinden gelir.IGF1, büyüme hormonunun ve IGF-1 DES'in büyümeyi teşvik edici etkilerinin çoğuna aracılık eder, ancak daha kısa olmasına rağmen, eşit miktarda fizyolojik değiştiren protein fiziksel değişikliklerini gerçekleştirir.İlk çalışmalar, büyüme hormonunun, sülfatın kıkırdağa dahil edilmesini doğrudan uyarmadığını, bunun yerine, daha sonra 'somatomedin' veya IGF-1 olarak bilinen ve daha yakın zamanda, DES'in kesilmesi yoluyla 'sülfasyon faktörü' olarak adlandırılan bir serum faktörü aracılığıyla hareket ettiğini gösterdi. IGF-1.

 

CAS 946870-92-4 İnsan Büyümesi Peptidleri IGF-1 DES 1mg İnsülin Benzeri Büyüme Faktörü UZUN İGF-1 0

 

Dozaj:

 

DES IGF-1, belirli hedef alanlara günde birçok kez (eğitimden önce) 50-150 mcg'de dozlanabilir.DES çok kısa bir yarı ömre sahip olduğundan (20-30 dakika), duyarsızlaşma hiç fark edilmedi.Enjeksiyon yerleri lokalize edilmelidir;tercihen büyümek istediğiniz kas grubunda.Basit bir ifadeyle, pazılarınızı büyütmek istiyorsanız, IGF-1 DES'yi doğrudan pazınıza enjekte edin.

 

IGF-1 ve HGH:

 

Neden GH değil de IGF-1?Büyüme hormonu aslında IGF-1'in öncüsüdür.Büyüme hormonu doğrudan kas büyümesine neden olmaz, ancak dolaylı olarak IGF-1'in salınımını işaret ederek kas büyümesine neden olur.İnsan Büyüme Hormonu (HGH) çok pahalı olabilir ve kas büyümesini görmek için insülin veya diğer anabolik steroidlerle eşleştirilmesi gerekir.Bu, bağımsız bir ilaç olarak kullanılabilen LR3 ve DES gibi IGF-1 varyantlarını, hasarlı doku ve kas büyümesinin sağlam bir şekilde iyileşmesini görmek isteyen vücut geliştiriciler için çok daha uygun bir seçenek haline getirir.

 

Alıcı Derecesi ve Medya Derecesi IGF-1 LR3:


Orijinal Reseptör Derecesi LR3 IGF-I, hücre büyümesi, IGF reseptörleri ve IGF bağlayıcı proteinler üzerinde yapılan çalışmalarda kullanım için yüksek kaliteli bir araştırma reaktifidir ve hem in vivo hem de in vitro olarak rH IGF-1 ve Media Grade IGF-1 LR3'ten daha güçlüdür. biyolojik aktivitede (IGF reseptörü ile bağlanma için daha güçlü afinite) ve yüksek düzeyde saflıkta şiddetli artışa.Artırılmış biyolojik aktivite ve saflığın bu kombinasyonu, Reseptör Derecesi IGF-1 LR3'ü standart IGF-1'den ayıran şeydir.Ortam sınıfı LR3 IGF-I, memelilere kıyasla ticari hücre kültüründe daha yaygın olarak kullanılır.Biyolojik potensin daha az değerli olduğu ve daha yüksek miktarların gerekli olduğu çalışmalara olanak sağlamak için ekonomik bir maliyetle bir araştırma reaktifi olarak da kullanılabilir.Hayvan bazlı hücre çalışmasında veya üretiminde sonuçları en üst düzeye çıkarmak için Reseptör Sınıfı IGF-1 Uzun R3 özel olarak kullanılmalıdır.

 

Herhangi bir yeniden sevkiyat politikanız var mı?

 

Parsel kaybederse, iyi bir satış sonrası servis ve yeniden sevkiyat politikamız var.
Müşterilerimizle olan uzun süreli birlikteliğimiz büyük faydalar sağladı.
Ürünlerimizin paketlenmesinde her zaman azami özeni göstermekteyiz.
Müşterilerimiz, zaman zaman onları yardım almadan bulmakta zorlandıkları için bunu onaylayacaktır.
Ancak, tüm çabalarımıza rağmen, az sayıda paketi ele geçirmemiz hala mümkün.
Bu durumda, uzun vadeli bir ilişki kurmak için ücretsiz yeniden gönderme sözü veriyoruz.

 

Nakliye:

 

1. 50KG'den az miktar için tercihen DHL veya HKEMS;
2. 60KG üzerindeki miktarlar için deniz nakliyesi.%100 güvenli!
3. Hollanda, Singapur, Laos, ABD'deki acentemizden gönderin

 

Herhangi bir ihtiyaç, lütfen bana ulaşın

E-posta: tonyraws810@gmail.com

Whatsapp: 86-15871352379

Wickr: tonyraws

İletişim bilgileri
Sales Manager

Telefon numarası : +8613657291547

Naber : +https://api.whatsapp.com/send?phone=8615871352379